SwePub
Sök i LIBRIS databas

  Extended search

id:"swepub:oai:DiVA.org:kth-223121"
 

Search: id:"swepub:oai:DiVA.org:kth-223121" > Membrane interactio...

  • 1 of 1
  • Previous record
  • Next record
  •    To hitlist

Membrane interactions of microgels as carriers of antimicrobial peptides

Nordström, Randi (author)
Uppsala University,Uppsala universitet,Institutionen för farmaci
Nyström, Lina (author)
Uppsala University,Uppsala universitet,Institutionen för farmaci
Andrén, Oliver C. J. (author)
KTH Royal Institute of Technology,KTH,Fiber- och polymerteknologi,Royal Inst Technol, Dept Fibre & Polymer Technol, SE-10044 Stockholm, Sweden.
show more...
Malkoch, Michael, 1974- (author)
KTH Royal Institute of Technology,Uppsala universitet,KTH,Fiber- och polymerteknologi,Royal Inst Technol, Dept Fibre & Polymer Technol, SE-10044 Stockholm, Sweden.,Institutionen för farmaci,Univ Copenhagen, Dept Pharm, DK-2100 Copenhagen, Denmark.
Umerska, A. (author)
Univ Bretagne Loire, CNRS 6021, INSERM U1066, Univ Angers,MINT, Angers, France.
Davoudi, Mina (author)
Lund University,Lunds universitet,Schmidtchen lab,Forskargrupper vid Lunds universitet,Schmidtchen Lab,Lund University Research Groups
Schmidtchen, Artur (author)
Lund University,Lunds universitet,Schmidtchen lab,Forskargrupper vid Lunds universitet,Schmidtchen Lab,Lund University Research Groups,Nanyang Technological University
Malmsten, Martin (author)
Uppsala University,University of Copenhagen
show less...
 (creator_code:org_t)
Academic Press Inc. 2018
2018
English.
In: Journal of Colloid and Interface Science. - : Academic Press Inc.. - 0021-9797 .- 1095-7103. ; 513, s. 141-150
  • Journal article (peer-reviewed)
Abstract Subject headings
Close  
  • Microgels are interesting as potential delivery systems for antimicrobial peptides. In order to elucidate membrane interactions of such systems, we here investigate effects of microgel charge density on antimicrobial peptide loading and release, as well as consequences of this for membrane interactions and antimicrobial effects, using ellipsometry, circular dichroism spectroscopy, nanoparticle tracking analysis, dynamic light scattering and z-potential measurements. Anionic poly(ethyl acrylate-co-methacrylic acid) microgels were found to incorporate considerable amounts of the cationic antimicrobial peptides LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW) and to protect incorporated peptides from degradation by infection-related proteases at high microgel charge density. As a result of their net negative z-potential also at high peptide loading, neither empty nor peptide-loaded microgels adsorb at supported bacteria-mimicking membranes. Instead, membrane disruption is mediated almost exclusively by peptide release. Mirroring this, antimicrobial effects against several clinically relevant bacteria (methicillin-resistant Staphylococcus aureus (MRSA), Escherichia coli, and Pseudomonas aeruginosa) were found to be promoted by factors facilitating peptide release, such as decreasing peptide length and decreasing microgel charge density. Microgels were further demonstrated to display low toxicity towards erythrocytes. Taken together, the results demonstrate some interesting opportunities for the use of microgels as delivery systems for antimicrobial peptides, but also highlight several key factors which need to be controlled for their successful use. 

Subject headings

NATURVETENSKAP  -- Kemi (hsv//swe)
NATURAL SCIENCES  -- Chemical Sciences (hsv//eng)
NATURVETENSKAP  -- Kemi -- Fysikalisk kemi (hsv//swe)
NATURAL SCIENCES  -- Chemical Sciences -- Physical Chemistry (hsv//eng)
TEKNIK OCH TEKNOLOGIER  -- Medicinteknik -- Medicinsk material- och protesteknik (hsv//swe)
ENGINEERING AND TECHNOLOGY  -- Medical Engineering -- Medical Materials (hsv//eng)
MEDICIN OCH HÄLSOVETENSKAP  -- Medicinska och farmaceutiska grundvetenskaper -- Farmaceutiska vetenskaper (hsv//swe)
MEDICAL AND HEALTH SCIENCES  -- Basic Medicine -- Pharmaceutical Sciences (hsv//eng)

Keyword

Antimicrobial peptide
Drug delivery
Lipid membrane
Microgel
Bacteria
Charge density
Circular dichroism spectroscopy
Dichroism
Drug interactions
Escherichia coli
Gels
Light scattering
Membranes
Microorganisms
Polypeptides
Anti-microbial effects
Cationic antimicrobial peptides
Lipid membranes
Methicillin-resistant staphylococcus aureus
Nanoparticle tracking analysis
Pseudomonas aeruginosa
Peptides
anion
cathelicidin antimicrobial peptide LL 37
cation
dpk 060
drug carrier
poly(acrylate methacrylate)
poly(ethyl methacrylate)
polypeptide antibiotic agent
proteinase
triton x 100
unclassified drug
adsorption kinetics
analytic method
aqueous solution
Article
bacterial membrane
bactericidal activity
binding kinetics
cell interaction
circular dichroism
conformational transition
controlled study
cytotoxicity
drug delivery system
drug distribution
drug release
electrical parameters
ellipsometry
erythrocyte
gel
hemolysis assay
hydrophobicity
in vitro study
ionic strength
membrane damage
methicillin resistant Staphylococcus aureus
minimum inhibitory concentration
nanoencapsulation
nonhuman
particle size
photon correlation spectroscopy
priority journal
protein degradation
protein secretion
protein stability
static electricity
zeta potential
Antimicrobial peptide
Drug delivery
Lipid membrane
Microgel

Publication and Content Type

ref (subject category)
art (subject category)

Find in a library

To the university's database

  • 1 of 1
  • Previous record
  • Next record
  •    To hitlist

Kungliga biblioteket hanterar dina personuppgifter i enlighet med EU:s dataskyddsförordning (2018), GDPR. Läs mer om hur det funkar här.
Så här hanterar KB dina uppgifter vid användning av denna tjänst.

 
pil uppåt Close

Copy and save the link in order to return to this view