Search: id:"swepub:oai:DiVA.org:kth-223121" >
Membrane interactio...
Membrane interactions of microgels as carriers of antimicrobial peptides
-
- Nordström, Randi (author)
- Uppsala University,Uppsala universitet,Institutionen för farmaci
-
- Nyström, Lina (author)
- Uppsala University,Uppsala universitet,Institutionen för farmaci
-
- Andrén, Oliver C. J. (author)
- KTH Royal Institute of Technology,KTH,Fiber- och polymerteknologi,Royal Inst Technol, Dept Fibre & Polymer Technol, SE-10044 Stockholm, Sweden.
-
show more...
-
- Malkoch, Michael, 1974- (author)
- KTH Royal Institute of Technology,Uppsala universitet,KTH,Fiber- och polymerteknologi,Royal Inst Technol, Dept Fibre & Polymer Technol, SE-10044 Stockholm, Sweden.,Institutionen för farmaci,Univ Copenhagen, Dept Pharm, DK-2100 Copenhagen, Denmark.
-
- Umerska, A. (author)
- Univ Bretagne Loire, CNRS 6021, INSERM U1066, Univ Angers,MINT, Angers, France.
-
- Davoudi, Mina (author)
- Lund University,Lunds universitet,Schmidtchen lab,Forskargrupper vid Lunds universitet,Schmidtchen Lab,Lund University Research Groups
-
- Schmidtchen, Artur (author)
- Lund University,Lunds universitet,Schmidtchen lab,Forskargrupper vid Lunds universitet,Schmidtchen Lab,Lund University Research Groups,Nanyang Technological University
-
- Malmsten, Martin (author)
- Uppsala University,University of Copenhagen
-
show less...
-
(creator_code:org_t)
- Academic Press Inc. 2018
- 2018
- English.
-
In: Journal of Colloid and Interface Science. - : Academic Press Inc.. - 0021-9797 .- 1095-7103. ; 513, s. 141-150
- Related links:
-
http://dx.doi.org/10...
-
show more...
-
https://urn.kb.se/re...
-
https://doi.org/10.1...
-
https://urn.kb.se/re...
-
https://lup.lub.lu.s...
-
show less...
Abstract
Subject headings
Close
- Microgels are interesting as potential delivery systems for antimicrobial peptides. In order to elucidate membrane interactions of such systems, we here investigate effects of microgel charge density on antimicrobial peptide loading and release, as well as consequences of this for membrane interactions and antimicrobial effects, using ellipsometry, circular dichroism spectroscopy, nanoparticle tracking analysis, dynamic light scattering and z-potential measurements. Anionic poly(ethyl acrylate-co-methacrylic acid) microgels were found to incorporate considerable amounts of the cationic antimicrobial peptides LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW) and to protect incorporated peptides from degradation by infection-related proteases at high microgel charge density. As a result of their net negative z-potential also at high peptide loading, neither empty nor peptide-loaded microgels adsorb at supported bacteria-mimicking membranes. Instead, membrane disruption is mediated almost exclusively by peptide release. Mirroring this, antimicrobial effects against several clinically relevant bacteria (methicillin-resistant Staphylococcus aureus (MRSA), Escherichia coli, and Pseudomonas aeruginosa) were found to be promoted by factors facilitating peptide release, such as decreasing peptide length and decreasing microgel charge density. Microgels were further demonstrated to display low toxicity towards erythrocytes. Taken together, the results demonstrate some interesting opportunities for the use of microgels as delivery systems for antimicrobial peptides, but also highlight several key factors which need to be controlled for their successful use.
Subject headings
- NATURVETENSKAP -- Kemi (hsv//swe)
- NATURAL SCIENCES -- Chemical Sciences (hsv//eng)
- NATURVETENSKAP -- Kemi -- Fysikalisk kemi (hsv//swe)
- NATURAL SCIENCES -- Chemical Sciences -- Physical Chemistry (hsv//eng)
- TEKNIK OCH TEKNOLOGIER -- Medicinteknik -- Medicinsk material- och protesteknik (hsv//swe)
- ENGINEERING AND TECHNOLOGY -- Medical Engineering -- Medical Materials (hsv//eng)
- MEDICIN OCH HÄLSOVETENSKAP -- Medicinska och farmaceutiska grundvetenskaper -- Farmaceutiska vetenskaper (hsv//swe)
- MEDICAL AND HEALTH SCIENCES -- Basic Medicine -- Pharmaceutical Sciences (hsv//eng)
Keyword
- Antimicrobial peptide
- Drug delivery
- Lipid membrane
- Microgel
- Bacteria
- Charge density
- Circular dichroism spectroscopy
- Dichroism
- Drug interactions
- Escherichia coli
- Gels
- Light scattering
- Membranes
- Microorganisms
- Polypeptides
- Anti-microbial effects
- Cationic antimicrobial peptides
- Lipid membranes
- Methicillin-resistant staphylococcus aureus
- Nanoparticle tracking analysis
- Pseudomonas aeruginosa
- Peptides
- anion
- cathelicidin antimicrobial peptide LL 37
- cation
- dpk 060
- drug carrier
- poly(acrylate methacrylate)
- poly(ethyl methacrylate)
- polypeptide antibiotic agent
- proteinase
- triton x 100
- unclassified drug
- adsorption kinetics
- analytic method
- aqueous solution
- Article
- bacterial membrane
- bactericidal activity
- binding kinetics
- cell interaction
- circular dichroism
- conformational transition
- controlled study
- cytotoxicity
- drug delivery system
- drug distribution
- drug release
- electrical parameters
- ellipsometry
- erythrocyte
- gel
- hemolysis assay
- hydrophobicity
- in vitro study
- ionic strength
- membrane damage
- methicillin resistant Staphylococcus aureus
- minimum inhibitory concentration
- nanoencapsulation
- nonhuman
- particle size
- photon correlation spectroscopy
- priority journal
- protein degradation
- protein secretion
- protein stability
- static electricity
- zeta potential
- Antimicrobial peptide
- Drug delivery
- Lipid membrane
- Microgel
Publication and Content Type
- ref (subject category)
- art (subject category)
Find in a library
To the university's database