1. |
-
- 2019
-
Tidskriftsartikel (refereegranskat)
|
|
2. |
- Li, Yingming, et al.
(författare)
-
Reduction of atmospheric polychlorinated dibenzo-p-dioxins and dibenzofurans (PCDD/Fs) during the 2008 Beijing Olympic games
- 2011
-
Ingår i: Environmental Science and Technology. - : American Chemical Society (ACS). - 0013-936X .- 1520-5851. ; 45:8, s. 3304-3309
-
Tidskriftsartikel (refereegranskat)abstract
- A total of 120 air samples were collected at three urban and one rural location in Beijing, China in the summers of 2007-2010, and before, during, and after the Beijing 2008 Olympic Games (BOG), in order to assess the effectiveness of long-term and short-term emission-control measures in reducing polychlorinated dibenzo-p-dioxins and dibenzofurans (PCDD/Fs) in the atmosphere. During the BOG (August, 2008), the PCDD/Fs concentrations decreased to an average value of 1150 fg m−3 (63 fg I-TEQ m−3), which was reduced by approximately 70% from the average in 2007 and by 29% from that in July 2008, before the Olympic event began. Although 2009-2010 levels of PCDD/Fs were significantly higher than 2008, the overall temporal trend was decreasing for summer months during the sampling campaign period. The apparent half-lives of atmospheric PCDD/Fs were estimated to be 3.2-5.8 years by statistically regressing the logarithm PCDD/Fs concentrations versus the number of years passed since 2006. The air concentrations of total suspended particulates (TSP) during the BOG ranged between 135 and 183 μg m−3, showing a 52% reduction from 2007 and 26% decrease from those prior to the Olympic event. No significant relationships were found between meteorological parameters (temperature, humidity, and wind speed) and PCDD/Fs or TSP during the BOG, whereas the PCDD/Fs concentrations were significantly dependent on the air quality (p < 0.05, positive against TSP and negative against visibility). This work is one of few temporal trend studies of atmospheric PCDD/Fs in mainland China, and provides unique insight into the effects of large-scale control measures in improving air quality and reducing one of the most ubiquitous and toxic organic pollutants in the environment.
|
|
3. |
- Wen, Wanqing, et al.
(författare)
-
Genome-wide association studies in East Asians identify new loci for waist-hip ratio and waist circumference
- 2016
-
Ingår i: Scientific Reports. - : Springer Science and Business Media LLC. - 2045-2322. ; 6
-
Tidskriftsartikel (refereegranskat)abstract
- Sixty genetic loci associated with abdominal obesity, measured by waist circumference (WC) and waist-hip ratio (WHR), have been previously identified, primarily from studies conducted in Europeanancestry populations. We conducted a meta-analysis of associations of abdominal obesity with approximately 2.5 million single nucleotide polymorphisms (SNPs) among 53,052 (for WC) and 48,312 (for WHR) individuals of Asian descent, and replicated 33 selected SNPs among 3,762 to 17,110 additional individuals. We identified four novel loci near the EFEMP1, ADAMTSL3, CNPY2, and GNAS genes that were associated with WC after adjustment for body mass index (BMI); two loci near the NID2 and HLA-DRB5 genes associated with WHR after adjustment for BMI, and three loci near the CEP120, TSC22D2, and SLC22A2 genes associated with WC without adjustment for BMI. Functional enrichment analyses revealed enrichment of corticotropin-releasing hormone signaling, GNRH signaling, and/or CDK5 signaling pathways for those newly-identified loci. Our study provides additional insight on genetic contribution to abdominal obesity.
|
|
4. |
- Li, Donggang, et al.
(författare)
-
Reactive Diffusion at the Liquid Al/Solid Cu Interface in a High Magnetic Field
- 2011
-
Ingår i: Materials and Manufacturing Processes. - : Informa UK Limited. - 1042-6914 .- 1532-2475. ; 26:6, s. 821-825
-
Tidskriftsartikel (refereegranskat)abstract
- The kinetics of the reactive diffusion at the liquid Al/solid Cu interface was investigated at T = 973 K, 1023 K, and 1073K in a high magnetic field of 11.5 T. During the annealing process, three stable compounds (delta, xi(2), and eta(2)) layers were formed at the interface of the couples, and a power function relationship between the mean thickness of the diffusion layers and the annealing time kept stable. Without magnetic field, the exponent of the power function for each compound layer was higher than 0.5, but it was close to or even smaller than 0.5 with a magnetic field. Compared with the field-free environment, the migration of the liquid/solid interface due to interdiffusion decreased in the presence of a magnetic field. A considerable decrease in the effective diffusion coefficient under a magnetic field provided a likely explanation for the experimental results.
|
|
5. |
- Li, Xiaomin, et al.
(författare)
-
A review of industrial wireless networks in the context of Industry 4.0
- 2017
-
Ingår i: Wireless networks. - : Springer. - 1022-0038 .- 1572-8196. ; 23:1, s. 23-41
-
Tidskriftsartikel (refereegranskat)abstract
- There have been many recent advances in wireless communication technologies, particularly in the area of wireless sensor networks, which have undergone rapid development and been successfully applied in the consumer electronics market. Therefore, wireless networks (WNs) have been attracting more attention from academic communities and other domains. From an industrial perspective, WNs present many advantages including flexibility, low cost, easy deployment and so on. Therefore, WNs can play a vital role in the Industry 4.0 framework, and can be used for smart factories and intelligent manufacturing systems. In this paper, we present an overview of industrial WNs (IWNs), discuss IWN features and related techniques, and then provide a new architecture based on quality of service and quality of data for IWNs. We also propose some applications for IWNs and IWN standards. Then, we will use a case from our previous achievements to explain how to design an IWN under Industry 4.0. Finally, we highlight some of the design challenges and open issues that still need to be addressed to make IWNs truly ubiquitous for a wide range of applications.
|
|
6. |
- Li, Yingming, et al.
(författare)
-
Atmospheric distribution of polychlorinated dibenzo-p-dioxins, dibenzofurans and dioxin-like polychlorinated biphenyls around a steel plant area, northeast China
- 2010
-
Ingår i: Chemosphere. - : Elsevier BV. - 0045-6535 .- 1879-1298. ; 79:3, s. 253-258
-
Tidskriftsartikel (refereegranskat)abstract
- Air monitoring of polychlorinated dibenzo-p-dioxins (PCDDs), polychlorinated dibenzofurans (PCDFs), and dioxin-like polychlorinated biphenyls (PCBs) was carried out in June 2008 and January 2009 to investigate the concentrations, profiles and estimating potential inhalation risks to the local residents around a steel plant area in northeast China. The air concentrations and WHO-TEQs of PCDD/Fs ranged 94-4944fgm(-3) (average 1352fgm(-3)) and 3-247fgm(-3) (average 81fgm(-3)), respectively. The WHO-TEQ concentrations of dioxin-like PCBs ranged 1-18fgm(-3) (average 5fgm(-3)), contributing to 3.6-26% of the total TEQ. Higher PCDD/F concentrations were observed in the winter, whereas higher dioxin-like PCB concentrations were found in the summer. The seasonal trend can be related to the significant correlation between the concentrations of dioxins and the reciprocal of temperature (positive for PCDD/Fs, P<0.01; negative for dioxin-like PCBs, P=0.05). A significant positive correlation (P<0.0001) was found between the concentration of total suspended particulate (TSP) and PCDD/F concentrations, but not for PCB congeners. Although the steel plant sites showed higher dioxin levels than the residential and background areas, the PCDD/F levels in the atmosphere of the steel plant area was at a relatively low level. The results from this study provides further aid in evaluating the impact of steel plants as PCDD/Fs emission sources to the ambient air in China.
|
|
7. |
- Wang, Pu, et al.
(författare)
-
Altitude dependence of polychlorinated biphenyls (PCBs) and polybrominated diphenyl ethers (PBDEs) in surface soil from Tibetan Plateau, China
- 2009
-
Ingår i: Chemosphere. - : Elsevier. - 0045-6535 .- 1879-1298. ; 76:11, s. 1498-1504
-
Tidskriftsartikel (refereegranskat)abstract
- Remote mountain areas besides high latitude regions are beginning to receive increased attention in studying the transport and behavior of persistent organic pollutants (POPs). In the present work, surface soil samples were collected from the Tibetan Plateau, the highest plateau in the world which includes the northern slope of Mt. Qomolangma, to investigate the levels and trends of polychlorinated biphenyls (PCBs) and polybrominated diphenyl ethers (PBDEs) along the altitudinal gradient. The average PCB and PBDE concentrations were 185.6 ng kg-1 dry weight (dw) (range 47.1-422.6 ng kg-1 dw) and 11.1 ng kg-1 dw (range 4.3-34.9 ng kg-1 dw), respectively. Regression analysis between the log-transformed TOC-normalized concentrations and the altitudes of the sampling sites showed two opposite trends with regard to altitude dependence: negative relationship with altitude below about 4500 m followed by a positive altitude dependence above this point. Considering minimum anthropogenic activities and very sparse precipitation in the north of Himalayas, the trends above 4500 m imply that the significant altitude dependence of these two groups of POPs were irrespective of pollution sources, but could be predicted by the global distillation effect involving cold condensation in high altitude mountain areas. Increasing levels of heavier congeners were found in higher altitude sites, although the lighter congeners were the main contributors to the total amount, suggesting that less volatile congeners seem to become enriched easier than those more volatile at higher altitudes in this region.
|
|
8. |
- Zhang, Xiao, et al.
(författare)
-
Heparanase overexpression impedes perivascular clearance of amyloid-beta from murine brain : relevance to Alzheimer's disease
- 2021
-
Ingår i: Acta neuropathologica communications. - : BioMed Central (BMC). - 2051-5960. ; 9
-
Tidskriftsartikel (refereegranskat)abstract
- Defective amyloid-beta (A beta) clearance from the brain is a major contributing factor to the pathophysiology of Alzheimer's disease (AD). A beta clearance is mediated by macrophages, enzymatic degradation, perivascular drainage along the vascular basement membrane (VBM) and transcytosis across the blood-brain barrier (BBB). AD pathology is typically associated with cerebral amyloid angiopathy due to perivascular accumulation of A beta. Heparan sulfate (HS) is an important component of the VBM, thought to fulfill multiple roles in AD pathology. We previously showed that macrophage-mediated clearance of intracortically injected A beta was impaired in the brains of transgenic mice overexpressing heparanase (Hpa-tg). This study revealed that perivascular drainage was impeded in the Hpa-tg brain, evidenced by perivascular accumulation of the injected A beta in the thalamus of Hpa-tg mice. Furthermore, endogenous A beta accumulated at the perivasculature of Hpa-tg thalamus, but not in control thalamus. This perivascular clearance defect was confirmed following intracortical injection of dextran that was largely retained in the perivasculature of Hpa-tg brains, compared to control brains. Hpa-tg brains presented with thicker VBMs and swollen perivascular astrocyte endfeet, as well as elevated expression of the BBB-associated water-pump protein aquaporin 4 (AQP4). Elevated levels of both heparanase and AQP4 were also detected in human AD brain. These findings indicate that elevated heparanase levels alter the organization and composition of the BBB, likely through increased fragmentation of BBB-associated HS, resulting in defective perivascular drainage. This defect contributes to perivascular accumulation of A beta in the Hpa-tg brain, highlighting a potential role for heparanase in the pathogenesis of AD.
|
|
9. |
- Zhang, Youwei, et al.
(författare)
-
Photothermoelectric and photovoltaic effects both present in MoS2
- 2015
-
Ingår i: Scientific Reports. - : Springer Science and Business Media LLC. - 2045-2322. ; 5, s. 7938-
-
Tidskriftsartikel (refereegranskat)abstract
- As a finite-energy-bandgap alternative to graphene, semiconducting molybdenum disulfide (MoS2) has recently attracted extensive interest for energy and sensor applications. In particular for broad-spectral photodetectors, multilayer MoS2 is more appealing than its monolayer counterpart. However, little is understood regarding the physics underlying the photoresponse of multilayer MoS2. Here, we employ scanning photocurrent microscopy to identify the nature of photocurrent generated in multilayer MoS2 transistors. The generation and transport of photocurrent in multilayer MoS2 are found to differ from those in other low-dimensional materials that only contribute with either photovoltaic effect (PVE) or photothermoelectric effect (PTE). In multilayer MoS2, the PVE at the MoS2-metal interface dominates in the accumulation regime whereas the hot-carrier-assisted PTE prevails in the depletion regime. Besides, the anomalously large Seebeck coefficient observed in multilayer MoS2, which has also been reported by others, is caused by hot photo-excited carriers that are not in thermal equilibrium with the MoS2 lattice.
|
|
10. |
- Häffner, Sara Malekkhaiat, et al.
(författare)
-
Membrane Interactions of Virus-like Mesoporous Silica Nanoparticles
- 2021
-
Ingår i: ACS Nano. - : American Chemical Society (ACS). - 1936-0851 .- 1936-086X. ; 15:4, s. 6787-6800
-
Tidskriftsartikel (refereegranskat)abstract
- In the present study, we investigated lipid membrane interactions of silica nanoparticles as carriers for the antimicrobial peptide LL-37 ([LL-37, 37 aa]). In doing so, smooth mesoporous nanoparticles were compared to virus-like mesoporous nanoparticles, characterized by a "spiky"external surface, as well as to nonporous silica nanoparticles. For this, we employed a combination of neutron reflectometry, ellipsometry, dynamic light scattering, and ζ-potential measurements for studies of bacteria-mimicking bilayers formed by palmitoyloleoylphosphatidylcholine/palmitoyloleoylphosphatidylglycerol. The results show that nanoparticle topography strongly influences membrane binding and destabilization. We found that virus-like particles are able to destabilize such lipid membranes, whereas the corresponding smooth silica nanoparticles are not. This effect of particle spikes becomes further accentuated after loading of such particles with LL-37. Thus, peptide-loaded virus-like nanoparticles displayed more pronounced membrane disruption than either peptide-loaded smooth nanoparticles or free LL-37. The structural basis of this was clarified by neutron reflectometry, demonstrating that the virus-like nanoparticles induce trans-membrane defects and promote incorporation of LL-37 throughout both bilayer leaflets. The relevance of such effects of particle spikes for bacterial membrane rupture was further demonstrated by confocal microscopy and live/dead assays on Escherichia coli bacteria. Taken together, these findings demonstrate that topography influences the interaction of nanoparticles with bacteria-mimicking lipid bilayers, both in the absence and presence of antimicrobial peptides, as well as with bacteria. The results also identify virus-like mesoporous nanoparticles as being of interest in the design of nanoparticles as delivery systems for antimicrobial peptides.
|
|
11. |
- Jia, Xiaomin, et al.
(författare)
-
Single crystal metal-organic framework constructed by vertically self-pillared nanosheets and its derivative for oriented lithium plating
- 2021
-
Ingår i: Cuihuà xuébào. - : Elsevier BV. - 0253-9837 .- 1872-2067. ; 42:9, s. 1553-1560
-
Tidskriftsartikel (refereegranskat)abstract
- This vertically self-pillared (VSP) structure extends the application range of traditional porous materials with facile mass/ion transport and enhanced reaction kinetics. Here, we prepare a single crystal metal-organic framework (MOF), employing the ZIF-67 structure as a proof of concept, which is constructed by vertically self-pillared nanosheets (VSP-MOF). We further converted VSP-MOF into VSP-cobalt sulfide (VSP-CoS2) through a sulfidation process. Catalysis plays an important role in almost all battery technologies; for metallic batteries, lithium anodes exhibit a high theoretical specific capacity, low density, and low redox potential. However, during the half-cell reaction (Li++e=Li), uncontrolled dendritic Li penetrates the separator and solid electrolyte interphase layer. When employed as a composite scaffold for lithium metal deposition, there are many advantage to using this framework: 1) the VSP-CoS2 substrate provides a high specific surface area to dissipate the ion flux and mass transfer and acts as a pre-catalyst, 2) the catalytic Co center favors the charge transfer process and preferentially binds the Li+ with the enhanced electrical fields, and 3) the VSP structure guides the metallic propagation along the nanosheet 2D orientation without the protrusive dendrites. All these features enable the VSP structure in metallic batteries with encouraging performances.
|
|
12. |
- Jiang, Jie, et al.
(författare)
-
Integrated direct DNA/protein patterning and microfabrication by focused ion beam milling
- 2008
-
Ingår i: Advanced Materials. - : John Wiley & Sons. - 0935-9648 .- 1521-4095. ; 20:9, s. 1636-1643
-
Tidskriftsartikel (refereegranskat)abstract
- Single and binary component patterning and integrated microfabrication of biomolecules, such as DNA and proteins, can be achieved by focused ion-beam (FIB) biolithography. Well-defined micropatterns are obtained by FIB milling on biomolecules immobilized on SiO2 wafers and protected by a thin Au film. The retention of biofunctionality is excellent (68–90%) and a feature size of down to 500 nm can be achieved for the patterns without significant loss of functionality.
|
|
13. |
- Li, Pu, et al.
(författare)
-
Self-balanced real-time photonic scheme for ultrafast random number generation
- 2018
-
Ingår i: APL PHOTONICS. - : AMER INST PHYSICS. - 2378-0967. ; 3:6
-
Tidskriftsartikel (refereegranskat)abstract
- We propose a real-time self-balanced photonic method for extracting ultrafast random numbers from broadband randomness sources. In place of electronic analog-to-digital converters (ADCs), the balanced photo-detection technology is used to directly quantize optically sampled chaotic pulses into a continuous random number stream. Benefitting from ultrafast photo-detection, our method can efficiently eliminate the generation rate bottleneck from electronic ADCs which are required in nearly all the available fast physical random number generators. A proof-of-principle experiment demonstrates that using our approach 10 Gb/s real-time and statistically unbiased random numbers are successfully extracted from a bandwidth-enhanced chaotic source. The generation rate achieved experimentally here is being limited by the bandwidth of the chaotic source. The method described has the potential to attain a real-time rate of 100 Gb/s.
|
|
14. |
- Li, Zichuan, et al.
(författare)
-
Impacts of silicon on biogeochemical cycles of carbon and nutrients in croplands
- 2018
-
Ingår i: Journal of Integrative Agriculture. - : Elsevier. - 2095-3119. ; 17:10, s. 2182-2195
-
Forskningsöversikt (refereegranskat)abstract
- Crop harvesting and residue removal from croplands often result in imbalanced biogeochemical cycles of carbon and nutrients in croplands, putting forward an austere challenge to sustainable agricultural production. As a beneficial element, silicon(Si) has multiple eco-physiological functions, which could help crops to acclimatize their unfavorable habitats. Although many studies have reported that the application of Si can alleviate multiple abiotic and biotic stresses and increase biomass accumulation, the effects of Si on carbon immobilization and nutrients uptake into plants in croplands have not yet been explored. This review focused on Si-associated regulation of plant carbon accumulation, lignin biosynthesis, and nutrients uptake, which are important for biogeochemical cycles of carbon and nutrients in croplands. The tradeoff analysis the supply of bioavailable Si can enhance plant net photosynthetic rate and biomass carbon production (especially root biomass input to soil organic carbon pool), but reduce shoot lignin biosynthesis. Besides, the application of Si could improve uptake of most nutrients under deficient conditions, but restricts excess uptake when they are supplied in surplus amounts. Nevertheless, Si application to crops may enhance the uptake of nitrogen and iron when they are supplied in deficient to luxurious amounts, while potassium uptake enhanced by Si application is often involved in alleviating salt stress and inhibiting excess sodium uptake in plants. More importantly, the amount of Si accumulated in plant positively correlates with nutrients release during the decay of crop biomass, but negatively correlates with straw decomposability due to the reduced lignin synthesis. The Si-mediated plant growth and litter decomposition collectively suggest that Si cycling in croplands plays important roles in biogeochemical cycles of carbon and nutrients. Hence, scientific Si management in croplands will be helpful for maintaining sustainable development of agriculture.
|
|
15. |
- Liu, Alei, et al.
(författare)
-
Manipulate Micrometer Surface and Nanometer Bulk Phase Separation Structures in the Active Layer of Organic Solar Cells via Synergy of Ultrasonic and High-Pressure Gas Spraying
- 2019
-
Ingår i: ACS Applied Materials and Interfaces. - : AMER CHEMICAL SOC. - 1944-8244 .- 1944-8252. ; 11:11, s. 10777-10784
-
Tidskriftsartikel (refereegranskat)abstract
- For organic solar cells, the vertical and lateral micro-/nanometer-scale structure in the active layer largely determines the device performance. In this work, the surface and bulk domain size of the photoactive layer are successfully manipulated with a facile two-step spraying method, that is, an ultrathin active layer by high-pressure spraying is deliberately stacked on top of the thick active layer by ultrasonic spraying. Thus, the morphology is effectively optimized with the comprehensive study of optical and electrical characteristics, such as photon absorption, exciton dissociation efficiency, and bimolecular recombination. Moreover, the novel method can be used not only in the fullerene system but also in the nonfullerene system, demonstrating the remarkable universality through this synergy method. This work provides an easy and reliable strategy to improve photovoltaic device performance in the industrial large-area spray-coating process.
|
|
16. |
- Meng, Zhou, et al.
(författare)
-
Observation of the lower hybrid waves near the three-dimensional null pair
- 2009
-
Ingår i: Science in China Series G. - : Science Press. - 1672-1799 .- 1862-2844. ; 52:4, s. 626-630
-
Tidskriftsartikel (refereegranskat)abstract
- Magnetic reconnection is a fundamental process in plasma, which is thought to play important roles both in laboratory and natural plasmas through affecting magnetic topology, heating and accelerating particles. During an event on Oct. 1st, 2001, the Cluster tetrahedron circled around the magnetic reconnection region several times, and Xiao et al. first identified the null pair and found that the spectrum of the null-point oscillation shows the maximum power near the lower-hybrid frequency. In this paper we report the observation of electromagnetic and electrostatic wave enhancements near lower hybrid frequency associated with the reconnection process near the null pair. The lower hybrid waves (LHWs) with quasi-perpendicular propagation were identified and also confirmed by the power law of the spectrum of electric and magnetic fields.
|
|
17. |
- Parra-Ortiz, Elisa, et al.
(författare)
-
Mesoporous silica as a matrix for photocatalytic titanium dioxide nanoparticles : lipid membrane interactions
- 2022
-
Ingår i: Nanoscale. - : Royal Society of Chemistry (RSC). - 2040-3364 .- 2040-3372. ; 14:34, s. 12297-12312
-
Tidskriftsartikel (refereegranskat)abstract
- In the present study, we investigate the combined interaction of mesoporous silica (SiO2) and photocatalytic titanium dioxide (TiO2) nanoparticles with lipid membranes, using neutron reflectometry (NR), cryo-transmission electron microscopy (cryo-TEM), fluorescence oxidation assays, dynamic light scattering (DLS), and ζ-potential measurements. Based on DLS, TiO2 nanoparticles were found to display strongly improved colloidal stability at physiological pH of skin (pH 5.4) after incorporation into either smooth or spiky (“virus-like”) mesoporous silica nanoparticles at low pH, the latter demonstrated by cryo-TEM. At the same time, such matrix-bound TiO2 nanoparticles retain their ability to destabilize anionic bacteria-mimicking lipid membranes under UV-illumination. Quenching experiments indicated both hydroxyl and superoxide radicals to contribute to this, while NR showed that free TiO2 nanoparticles and TiO2 loaded into mesoporous silica nanoparticles induced comparable effects on supported lipid membranes, including membrane thinning, lipid removal, and formation of a partially disordered outer membrane leaflet. By comparing effects for smooth and virus-like mesoporous nanoparticles as matrices for TiO2 nanoparticles, the interplay between photocatalytic and direct membrane binding effects were elucidated. Taken together, the study outlines how photocatalytic nanoparticles can be readily incorporated into mesoporous silica nanoparticles for increased colloidal stability and yet retain most of their capacity for photocatalytic destabilization of lipid membranes, and with maintained mechanisms for oxidative membrane destabilization. As such, the study provides new mechanistic information to the widely employed, but poorly understood, practice of loading photocatalytic nanomaterials onto/into matrix materials for increased performance.
|
|
18. |
- Sun, Xu, et al.
(författare)
-
Elevated heparanase expression is associated with poor prognosis in breast cancer : a study based on systematic review and TCGA data
- 2017
-
Ingår i: Oncotarget. - : IMPACT JOURNALS LLC. - 1949-2553. ; 8:26, s. 43521-43535
-
Forskningsöversikt (refereegranskat)abstract
- Heparanase promotes tumorigenesis, angiogenesis, and metastasis. Here, we conducted a study based on systematic review and the Cancer Genome Atlas (TCGA) data that examined heparanase expression in clinical samples to determine its prognostic value. According to the meta-analysis and TCGA data, we found that heparanase expression was up-regulated in most breast cancer specimens, and elevated heparanase expression was associated with increased lymph node metastasis, larger tumor size, higher histological grade, and poor survival. These results suggest that targeting heparanase might improve treatments for breast cancer patients.
|
|
19. |
- Wang, Pu, et al.
(författare)
-
Evaluation of Soxhlet extraction, accelerated solvent extraction and microwave-assisted extraction for the determination of polychlorinated biphenyls and polybrominated diphenyl ethers in soil and fish samples
- 2010
-
Ingår i: Analytica Chimica Acta. - : Elsevier. - 0003-2670 .- 1873-4324. ; 663:1, s. 43-48
-
Tidskriftsartikel (refereegranskat)abstract
- Three commonly applied extraction techniques for persistent organic chemicals, Soxhlet extraction (SE), accelerated solvent extraction (ASE) and microwave-assisted extraction (MAE), were applied on soil and fish samples in order to evaluate their performances. For both PCBs and PBDEs, the two more recent developed techniques (ASE and MAE) were in general capable of producing comparable extraction results as the classical SE, and even higher extraction recoveries were obtained for some PCB congeners with large octanol-water partitioning coefficients (K(ow)). This relatively uniform extraction results from ASE and MAE indicated that elevated temperature and pressure are favorable to the efficient extraction of PCBs from the solid matrices. For PBDEs, difference between the results from MAE and ASE (or SE) suggests that the MAE extraction condition needs to be carefully optimized according to the characteristics of the matrix and analyte to avoid degradation of higher brominated BDE congeners and improve the extraction yields.
|
|
20. |
- Wu, Lele, et al.
(författare)
-
Organic matter composition and stability in estuarine wetlands depending on soil salinity
- 2024
-
Ingår i: Science of the Total Environment. - 0048-9697 .- 1879-1026. ; 945
-
Tidskriftsartikel (refereegranskat)abstract
- Coastal wetlands are key players in mitigating global climate change by sequestering soil organic matter. Soil organic matter consists of less stable particulate organic matter (POM) and more stable mineral-associated organic matter (MAOM). The distribution and drivers of MAOM and POM in coastal wetlands have received little attention, despite the processes and mechanisms differ from that in the upland soils. We explored the distribution of POM and MAOM, their contributions to SOM, and the controlling factors along a salinity gradient in an estuarine wetland. In the estuarine wetland, POM C and N were influenced by soil depth and vegetation type, whereas MAOM C and N were influenced only by vegetation type. In the estuarine wetland, SOM was predominantly in the form of MAOM (> 70 %) and increased with salinity (70 %–76 %), leading to long-term C sequestration. Both POM and MAOM increased with SOM, and the increase rate of POM was higher than that of MAOM. Aboveground plant biomass decreased with increasing salinity, resulted in a decrease in POM C (46 %–81 %) and N (52 %–82 %) pools. As the mineral amount and activity, and microbial biomass decreased, the MAOM C (2.5 %–64 %) and N pool (8.6 %–59 %) decreased with salinity. When evaluating POM, the most influential factors were microbial biomass carbon (MBC) and dissolved organic carbon (DOC). Key parameters, including MBC, DOC, soil salinity, soil water content, aboveground plant biomass, mineral content and activity, and bulk density, were identified as influencing factors for both MAOM abundance. Soil water content not only directly controlled MAOM, but together with salinity also indirectly regulated POM and MAOM by controlling microbial biomass and aboveground plant biomass. Our findings have important implications for improving the accumulation and increased stability of soil organic matter in coastal wetlands, considering the global sea level rise and increased frequency of inundation.
|
|
21. |
- Yang, Shilei, et al.
(författare)
-
Impact of grassland degradation on the distribution and bioavailability of soil silicon: Implications for the Si cycle in grasslands
- 2019
-
Ingår i: Science of the Total Environment. - : Elsevier. - 0048-9697 .- 1879-1026. ; 657, s. 811-818
-
Tidskriftsartikel (refereegranskat)abstract
- Grassland ecosystems play an important role in the global terrestrial silicon (Si) cycle, and Si is a beneficial elementand structural constituent for the growth of grasses. In previous decades, grasslands have been degradedto different degrees because of the drying climate and intense human disturbance. However, the impact of grasslanddegradation on the distribution and bioavailability of soil Si is largely unknown. Here, we investigated vegetationand soil conditions of 30 sites to characterize different degrees of degradation for grasslands in the agropastoralecotone of northern China. We then explored the impact of grassland degradation on the distributionand bioavailability of soil Si, including total Si and four forms of noncrystalline Si in three horizons (0–10,10–20 and 20–40 cm) of different soil profiles. The concentrations of noncrystalline Si in soil profiles significantlydecreased with increasing degrees of degradation, being 7.35 ± 0.88 mg g−1, 5.36 ± 0.39 mg g−1, 3.81 ±0.37 mg g−1 and 3.60±0.26 mg g−1 in non-degraded, lightly degraded, moderately degraded and seriously degradedgrasslands, respectively. Moreover, the storage of noncrystalline Si decreased from higher than 40 t ha−1to lower than 23 t ha−1. The corresponding bioavailability of soil Si also generally decreased with grassland degradation.These processes may not only affect the Si pools and fluxes in soils but also influence the Si uptake in plants. We suggest that grassland degradation can significantly affect the global grassland Si cycle. Grasslandmanagement methods such as fertilizing and avoiding overgrazing can potentially double the content and storageof noncrystalline Si in soils, thereby enhancing the soil Si bioavailability by N17%.
|
|