1. |
-
- 2019
-
Tidskriftsartikel (refereegranskat)
|
|
2. |
- Li, Yingming, et al.
(författare)
-
Reduction of atmospheric polychlorinated dibenzo-p-dioxins and dibenzofurans (PCDD/Fs) during the 2008 Beijing Olympic games
- 2011
-
Ingår i: Environmental Science and Technology. - : American Chemical Society (ACS). - 0013-936X .- 1520-5851. ; 45:8, s. 3304-3309
-
Tidskriftsartikel (refereegranskat)abstract
- A total of 120 air samples were collected at three urban and one rural location in Beijing, China in the summers of 2007-2010, and before, during, and after the Beijing 2008 Olympic Games (BOG), in order to assess the effectiveness of long-term and short-term emission-control measures in reducing polychlorinated dibenzo-p-dioxins and dibenzofurans (PCDD/Fs) in the atmosphere. During the BOG (August, 2008), the PCDD/Fs concentrations decreased to an average value of 1150 fg m−3 (63 fg I-TEQ m−3), which was reduced by approximately 70% from the average in 2007 and by 29% from that in July 2008, before the Olympic event began. Although 2009-2010 levels of PCDD/Fs were significantly higher than 2008, the overall temporal trend was decreasing for summer months during the sampling campaign period. The apparent half-lives of atmospheric PCDD/Fs were estimated to be 3.2-5.8 years by statistically regressing the logarithm PCDD/Fs concentrations versus the number of years passed since 2006. The air concentrations of total suspended particulates (TSP) during the BOG ranged between 135 and 183 μg m−3, showing a 52% reduction from 2007 and 26% decrease from those prior to the Olympic event. No significant relationships were found between meteorological parameters (temperature, humidity, and wind speed) and PCDD/Fs or TSP during the BOG, whereas the PCDD/Fs concentrations were significantly dependent on the air quality (p < 0.05, positive against TSP and negative against visibility). This work is one of few temporal trend studies of atmospheric PCDD/Fs in mainland China, and provides unique insight into the effects of large-scale control measures in improving air quality and reducing one of the most ubiquitous and toxic organic pollutants in the environment.
|
|
3. |
- Wen, Wanqing, et al.
(författare)
-
Genome-wide association studies in East Asians identify new loci for waist-hip ratio and waist circumference
- 2016
-
Ingår i: Scientific Reports. - : Springer Science and Business Media LLC. - 2045-2322. ; 6
-
Tidskriftsartikel (refereegranskat)abstract
- Sixty genetic loci associated with abdominal obesity, measured by waist circumference (WC) and waist-hip ratio (WHR), have been previously identified, primarily from studies conducted in Europeanancestry populations. We conducted a meta-analysis of associations of abdominal obesity with approximately 2.5 million single nucleotide polymorphisms (SNPs) among 53,052 (for WC) and 48,312 (for WHR) individuals of Asian descent, and replicated 33 selected SNPs among 3,762 to 17,110 additional individuals. We identified four novel loci near the EFEMP1, ADAMTSL3, CNPY2, and GNAS genes that were associated with WC after adjustment for body mass index (BMI); two loci near the NID2 and HLA-DRB5 genes associated with WHR after adjustment for BMI, and three loci near the CEP120, TSC22D2, and SLC22A2 genes associated with WC without adjustment for BMI. Functional enrichment analyses revealed enrichment of corticotropin-releasing hormone signaling, GNRH signaling, and/or CDK5 signaling pathways for those newly-identified loci. Our study provides additional insight on genetic contribution to abdominal obesity.
|
|
4. |
- Li, Donggang, et al.
(författare)
-
Reactive Diffusion at the Liquid Al/Solid Cu Interface in a High Magnetic Field
- 2011
-
Ingår i: Materials and Manufacturing Processes. - : Informa UK Limited. - 1042-6914 .- 1532-2475. ; 26:6, s. 821-825
-
Tidskriftsartikel (refereegranskat)abstract
- The kinetics of the reactive diffusion at the liquid Al/solid Cu interface was investigated at T = 973 K, 1023 K, and 1073K in a high magnetic field of 11.5 T. During the annealing process, three stable compounds (delta, xi(2), and eta(2)) layers were formed at the interface of the couples, and a power function relationship between the mean thickness of the diffusion layers and the annealing time kept stable. Without magnetic field, the exponent of the power function for each compound layer was higher than 0.5, but it was close to or even smaller than 0.5 with a magnetic field. Compared with the field-free environment, the migration of the liquid/solid interface due to interdiffusion decreased in the presence of a magnetic field. A considerable decrease in the effective diffusion coefficient under a magnetic field provided a likely explanation for the experimental results.
|
|
5. |
- Li, Xiaomin, et al.
(författare)
-
A review of industrial wireless networks in the context of Industry 4.0
- 2017
-
Ingår i: Wireless networks. - : Springer. - 1022-0038 .- 1572-8196. ; 23:1, s. 23-41
-
Tidskriftsartikel (refereegranskat)abstract
- There have been many recent advances in wireless communication technologies, particularly in the area of wireless sensor networks, which have undergone rapid development and been successfully applied in the consumer electronics market. Therefore, wireless networks (WNs) have been attracting more attention from academic communities and other domains. From an industrial perspective, WNs present many advantages including flexibility, low cost, easy deployment and so on. Therefore, WNs can play a vital role in the Industry 4.0 framework, and can be used for smart factories and intelligent manufacturing systems. In this paper, we present an overview of industrial WNs (IWNs), discuss IWN features and related techniques, and then provide a new architecture based on quality of service and quality of data for IWNs. We also propose some applications for IWNs and IWN standards. Then, we will use a case from our previous achievements to explain how to design an IWN under Industry 4.0. Finally, we highlight some of the design challenges and open issues that still need to be addressed to make IWNs truly ubiquitous for a wide range of applications.
|
|
6. |
- Li, Yingming, et al.
(författare)
-
Atmospheric distribution of polychlorinated dibenzo-p-dioxins, dibenzofurans and dioxin-like polychlorinated biphenyls around a steel plant area, northeast China
- 2010
-
Ingår i: Chemosphere. - : Elsevier BV. - 0045-6535 .- 1879-1298. ; 79:3, s. 253-258
-
Tidskriftsartikel (refereegranskat)abstract
- Air monitoring of polychlorinated dibenzo-p-dioxins (PCDDs), polychlorinated dibenzofurans (PCDFs), and dioxin-like polychlorinated biphenyls (PCBs) was carried out in June 2008 and January 2009 to investigate the concentrations, profiles and estimating potential inhalation risks to the local residents around a steel plant area in northeast China. The air concentrations and WHO-TEQs of PCDD/Fs ranged 94-4944fgm(-3) (average 1352fgm(-3)) and 3-247fgm(-3) (average 81fgm(-3)), respectively. The WHO-TEQ concentrations of dioxin-like PCBs ranged 1-18fgm(-3) (average 5fgm(-3)), contributing to 3.6-26% of the total TEQ. Higher PCDD/F concentrations were observed in the winter, whereas higher dioxin-like PCB concentrations were found in the summer. The seasonal trend can be related to the significant correlation between the concentrations of dioxins and the reciprocal of temperature (positive for PCDD/Fs, P<0.01; negative for dioxin-like PCBs, P=0.05). A significant positive correlation (P<0.0001) was found between the concentration of total suspended particulate (TSP) and PCDD/F concentrations, but not for PCB congeners. Although the steel plant sites showed higher dioxin levels than the residential and background areas, the PCDD/F levels in the atmosphere of the steel plant area was at a relatively low level. The results from this study provides further aid in evaluating the impact of steel plants as PCDD/Fs emission sources to the ambient air in China.
|
|
7. |
- Wang, Pu, et al.
(författare)
-
Altitude dependence of polychlorinated biphenyls (PCBs) and polybrominated diphenyl ethers (PBDEs) in surface soil from Tibetan Plateau, China
- 2009
-
Ingår i: Chemosphere. - : Elsevier. - 0045-6535 .- 1879-1298. ; 76:11, s. 1498-1504
-
Tidskriftsartikel (refereegranskat)abstract
- Remote mountain areas besides high latitude regions are beginning to receive increased attention in studying the transport and behavior of persistent organic pollutants (POPs). In the present work, surface soil samples were collected from the Tibetan Plateau, the highest plateau in the world which includes the northern slope of Mt. Qomolangma, to investigate the levels and trends of polychlorinated biphenyls (PCBs) and polybrominated diphenyl ethers (PBDEs) along the altitudinal gradient. The average PCB and PBDE concentrations were 185.6 ng kg-1 dry weight (dw) (range 47.1-422.6 ng kg-1 dw) and 11.1 ng kg-1 dw (range 4.3-34.9 ng kg-1 dw), respectively. Regression analysis between the log-transformed TOC-normalized concentrations and the altitudes of the sampling sites showed two opposite trends with regard to altitude dependence: negative relationship with altitude below about 4500 m followed by a positive altitude dependence above this point. Considering minimum anthropogenic activities and very sparse precipitation in the north of Himalayas, the trends above 4500 m imply that the significant altitude dependence of these two groups of POPs were irrespective of pollution sources, but could be predicted by the global distillation effect involving cold condensation in high altitude mountain areas. Increasing levels of heavier congeners were found in higher altitude sites, although the lighter congeners were the main contributors to the total amount, suggesting that less volatile congeners seem to become enriched easier than those more volatile at higher altitudes in this region.
|
|
8. |
- Zhang, Xiao, et al.
(författare)
-
Heparanase overexpression impedes perivascular clearance of amyloid-beta from murine brain : relevance to Alzheimer's disease
- 2021
-
Ingår i: Acta neuropathologica communications. - : BioMed Central (BMC). - 2051-5960. ; 9
-
Tidskriftsartikel (refereegranskat)abstract
- Defective amyloid-beta (A beta) clearance from the brain is a major contributing factor to the pathophysiology of Alzheimer's disease (AD). A beta clearance is mediated by macrophages, enzymatic degradation, perivascular drainage along the vascular basement membrane (VBM) and transcytosis across the blood-brain barrier (BBB). AD pathology is typically associated with cerebral amyloid angiopathy due to perivascular accumulation of A beta. Heparan sulfate (HS) is an important component of the VBM, thought to fulfill multiple roles in AD pathology. We previously showed that macrophage-mediated clearance of intracortically injected A beta was impaired in the brains of transgenic mice overexpressing heparanase (Hpa-tg). This study revealed that perivascular drainage was impeded in the Hpa-tg brain, evidenced by perivascular accumulation of the injected A beta in the thalamus of Hpa-tg mice. Furthermore, endogenous A beta accumulated at the perivasculature of Hpa-tg thalamus, but not in control thalamus. This perivascular clearance defect was confirmed following intracortical injection of dextran that was largely retained in the perivasculature of Hpa-tg brains, compared to control brains. Hpa-tg brains presented with thicker VBMs and swollen perivascular astrocyte endfeet, as well as elevated expression of the BBB-associated water-pump protein aquaporin 4 (AQP4). Elevated levels of both heparanase and AQP4 were also detected in human AD brain. These findings indicate that elevated heparanase levels alter the organization and composition of the BBB, likely through increased fragmentation of BBB-associated HS, resulting in defective perivascular drainage. This defect contributes to perivascular accumulation of A beta in the Hpa-tg brain, highlighting a potential role for heparanase in the pathogenesis of AD.
|
|
9. |
- Zhang, Youwei, et al.
(författare)
-
Photothermoelectric and photovoltaic effects both present in MoS2
- 2015
-
Ingår i: Scientific Reports. - : Springer Science and Business Media LLC. - 2045-2322. ; 5, s. 7938-
-
Tidskriftsartikel (refereegranskat)abstract
- As a finite-energy-bandgap alternative to graphene, semiconducting molybdenum disulfide (MoS2) has recently attracted extensive interest for energy and sensor applications. In particular for broad-spectral photodetectors, multilayer MoS2 is more appealing than its monolayer counterpart. However, little is understood regarding the physics underlying the photoresponse of multilayer MoS2. Here, we employ scanning photocurrent microscopy to identify the nature of photocurrent generated in multilayer MoS2 transistors. The generation and transport of photocurrent in multilayer MoS2 are found to differ from those in other low-dimensional materials that only contribute with either photovoltaic effect (PVE) or photothermoelectric effect (PTE). In multilayer MoS2, the PVE at the MoS2-metal interface dominates in the accumulation regime whereas the hot-carrier-assisted PTE prevails in the depletion regime. Besides, the anomalously large Seebeck coefficient observed in multilayer MoS2, which has also been reported by others, is caused by hot photo-excited carriers that are not in thermal equilibrium with the MoS2 lattice.
|
|
10. |
- Häffner, Sara Malekkhaiat, et al.
(författare)
-
Membrane Interactions of Virus-like Mesoporous Silica Nanoparticles
- 2021
-
Ingår i: ACS Nano. - : American Chemical Society (ACS). - 1936-0851 .- 1936-086X. ; 15:4, s. 6787-6800
-
Tidskriftsartikel (refereegranskat)abstract
- In the present study, we investigated lipid membrane interactions of silica nanoparticles as carriers for the antimicrobial peptide LL-37 ([LL-37, 37 aa]). In doing so, smooth mesoporous nanoparticles were compared to virus-like mesoporous nanoparticles, characterized by a "spiky"external surface, as well as to nonporous silica nanoparticles. For this, we employed a combination of neutron reflectometry, ellipsometry, dynamic light scattering, and ζ-potential measurements for studies of bacteria-mimicking bilayers formed by palmitoyloleoylphosphatidylcholine/palmitoyloleoylphosphatidylglycerol. The results show that nanoparticle topography strongly influences membrane binding and destabilization. We found that virus-like particles are able to destabilize such lipid membranes, whereas the corresponding smooth silica nanoparticles are not. This effect of particle spikes becomes further accentuated after loading of such particles with LL-37. Thus, peptide-loaded virus-like nanoparticles displayed more pronounced membrane disruption than either peptide-loaded smooth nanoparticles or free LL-37. The structural basis of this was clarified by neutron reflectometry, demonstrating that the virus-like nanoparticles induce trans-membrane defects and promote incorporation of LL-37 throughout both bilayer leaflets. The relevance of such effects of particle spikes for bacterial membrane rupture was further demonstrated by confocal microscopy and live/dead assays on Escherichia coli bacteria. Taken together, these findings demonstrate that topography influences the interaction of nanoparticles with bacteria-mimicking lipid bilayers, both in the absence and presence of antimicrobial peptides, as well as with bacteria. The results also identify virus-like mesoporous nanoparticles as being of interest in the design of nanoparticles as delivery systems for antimicrobial peptides.
|
|