onr:"swepub:oai:DiVA.org:su-36658"
Search: onr:"swepub:oai:DiVA.org:su-36658" > Incorporation of an...
- 1 of 1
- Previous record
- Next record
- To hitlist
- Izquierdo-Barba, IsabelStockholms universitet,Avdelningen för oorganisk kemi och strukturkemi (author)
Incorporation of antimicrobial compounds in mesoporous silica film monolith
- Article/chapterEnglish2009
Publisher, publication year, extent ...
- Elsevier BV,2009
- printrdacarrier
Numbers
- LIBRIS-ID:oai:DiVA.org:su-36658
- https://urn.kb.se/resolve?urn=urn:nbn:se:su:diva-36658URI
- https://doi.org/10.1016/j.biomaterials.2009.07.003DOI
- https://lup.lub.lu.se/record/1490142URI
- https://urn.kb.se/resolve?urn=urn:nbn:se:uu:diva-109440URI
Supplementary language notes
- Language:English
- Summary in:English
Part of subdatabase
- SwePubSwePub
Classification
Notes
- : Incorporation of the antimicrobial peptide LL-37 ([LL-37, 37 aa]), as well as low molecular weight antimicrobial chlorhexidine, into mesoporous silica was obtained using an EISA one-pot synthesis method. FTIR confirmed efficient encapsulation of both LL-37 and chlorhexidine into mesoporous silica, while XRD and TEM showed that antimicrobial agent incorporation can be achieved without greatly affecting the structure of the mesoporous silica. The modified mesoporous silica released LL-37 and chlorhexidine slowly, reaching maximum release after about 200 h. The release rate could also be controlled through incorporation of SH groups in the pore walls, adding to pore hydrophobicity and reducing the release rate by about 50% compared to the unmodified mesoporous silica. Mesoporous silica containing either LL-37 or chlorhexidine displayed potent bactericidal properties against both Gram-positive Staphylococcus aureus and Gram-negative Escherichia coli. While chlorhexidine-loaded mesoporous silica displayed an accompanying high toxicity, as judged from hemolysis, LDH release, and MTT assay, the corresponding material containing LL-37 showed very low toxicity by all these assays, comparable to that observed for mesoporous silica in the absence of antibacterial drug, as well as to the negative controls in the respective assays. Mesoporous silica containing LL-37 therefore holds potential as an implantable material or a surface coating for such materials, as it combines potent bactericidal action with low toxicity, important features for controlling implant-related infections, e.g., for multi-resistant pathogens or for cases where access to the infection site of systemically administered antibiotics is limited due to collagen capsule formation or other factors.
Subject headings and genre
- NATURVETENSKAP Kemi Oorganisk kemi hsv//swe
- NATURAL SCIENCES Chemical Sciences Inorganic Chemistry hsv//eng
- TEKNIK OCH TEKNOLOGIER Industriell bioteknik Bioteknisk apparatteknik hsv//swe
- ENGINEERING AND TECHNOLOGY Industrial Biotechnology Bioengineering Equipment hsv//eng
- Antimicrobial
- Chlorhexidin
- LL-37
- Mesoporous
- Silica
- Inorganic chemistry
- Oorganisk kemi
- Inorganic Chemistry
- oorganisk kemi
- Silica
- Mesoporous
- LL-37
- Antimicrobial
- Chlorhexicline
- TECHNOLOGY
Added entries (persons, corporate bodies, meetings, titles ...)
- Kupferschmidt, NataliaUppsala universitet,Stockholms universitet,Avdelningen för oorganisk kemi och strukturkemi,Nanoteknologi och funktionella material(Swepub:uu)natku639 (author)
- Terasaki, OsamuStockholms universitet,Institutionen för fysikalisk kemi, oorganisk kemi och strukturkemi(Swepub:su)osate (author)
- Schmidtchen, ArturLund University,Lunds universitet,Dermatologi och venereologi, Lund,Sektion III,Institutionen för kliniska vetenskaper, Lund,Medicinska fakulteten,Dermatology and Venereology (Lund),Section III,Department of Clinical Sciences, Lund,Faculty of Medicine(Swepub:lu)derm-asc (author)
- Malmsten, MartinUppsala universitet,Uppsala University,Institutionen för farmaci(Swepub:uu)mamal991 (author)
- Vallet-Regí, Maria (author)
- Stockholms universitetAvdelningen för oorganisk kemi och strukturkemi (creator_code:org_t)
Related titles
- In:Biomaterials: Elsevier BV30:29, s. 5729-57360142-96121878-5905
Internet link
- 1 of 1
- Previous record
- Next record
- To hitlist
Find more in SwePub
- By the author/editor
- Izquierdo-Barba, ...
- Kupferschmidt, N ...
- Terasaki, Osamu
- Schmidtchen, Art ...
- Malmsten, Martin
- Vallet-Regí, Mar ...
- About the subject
-
- NATURAL SCIENCES
- NATURAL SCIENCES
- and Chemical Science ...
- and Inorganic Chemis ...
-
- ENGINEERING AND TECHNOLOGY
- ENGINEERING AND ...
- and Industrial Biote ...
- and Bioengineering E ...
- Articles in the publication
- Biomaterials
- By the university
- Stockholm University
- Lund University
- Uppsala University
Search outside SwePub
- Extend your search to:
- Google Book Search
- Google Scholar
Kungliga biblioteket hanterar dina personuppgifter i enlighet med EU:s dataskyddsförordning (2018), GDPR. Läs mer om hur det funkar här.
Så här hanterar KB dina uppgifter vid användning av denna tjänst.
- Copyright © LIBRIS - National Library Systems
- LIBRIS.kb.se
