Sökning: onr:"swepub:oai:DiVA.org:uu-395109" >
Membrane Interactio...
Membrane Interactions of Antimicrobial Peptide-Loaded Microgels
-
- Nordström, Randi (författare)
- Uppsala University,Uppsala universitet,Institutionen för farmaci,farmaceutisk fysikalisk kemi
-
- Browning, Kathryn L. (författare)
- Uppsala University,Uppsala universitet,Institutionen för farmaci,Univ Copenhagen, Dept Pharm, DK-2100 Copenhagen, Denmark,University of Copenhagen
-
- Parra-Ortiz, Elisa (författare)
- Univ Copenhagen, Dept Pharm, DK-2100 Copenhagen, Denmark,University of Copenhagen
-
visa fler...
-
- Dangaard, Liv Sofia Elinor (författare)
- Univ Copenhagen, Dept Pharm, DK-2100 Copenhagen, Denmark,University of Copenhagen
-
- Malekkhaiat-Häffner, Sara (författare)
- Univ Copenhagen, Dept Pharm, DK-2100 Copenhagen, Denmark,University of Copenhagen
-
- Maestro, Armando (författare)
- Inst Laue Langevin, F-38042 Grenoble 9, France,Institut Laue Langevin
-
- Campbell, Richard A. (författare)
- Inst Laue Langevin, F-38042 Grenoble 9, France;Univ Manchester, Div Pharm & Optometry, Manchester M13 9PT, Lancs, England,Institut Laue Langevin
-
- Cooper, Joshaniel F. K. (författare)
- Rutherford Appleton Lab, ISIS, Pulsed Neutron & Muon Source, Harwell OX11 0QX, Oxon, England,ISIS Neutron and Muon Source
-
- Malmsten, Martin (författare)
- Lund University,Lunds universitet,Fysikalisk kemi,Enheten för fysikalisk och teoretisk kemi,Kemiska institutionen,Institutioner vid LTH,Lunds Tekniska Högskola,Physical Chemistry,Physical and theoretical chemistry,Department of Chemistry,Departments at LTH,Faculty of Engineering, LTH,University of Copenhagen
-
visa färre...
-
(creator_code:org_t)
- Elsevier BV, 2020
- 2020
- Engelska.
-
Ingår i: Journal of Colloid and Interface Science. - : Elsevier BV. - 0021-9797 .- 1095-7103. ; 562, s. 322-332
- Relaterad länk:
-
https://www.research...
-
visa fler...
-
http://dx.doi.org/10...
-
https://urn.kb.se/re...
-
https://doi.org/10.1...
-
https://lup.lub.lu.s...
-
visa färre...
Abstract
Ämnesord
Stäng
- In the present study, lipid membrane interactions of anionic poly(ethyl acrylate-co-methacrylic acid) (MAA) microgels as carriers for the cationic antimicrobial peptide LL-37 ([LL-37, 37 aa]) were investigated. In doing so, neutron reflectometry (NR), Fourier-transform infrared spectroscopy with attenuated total reflection (FTIR-ATR), zeta potential, ellipsometry, and circular dichroism spectroscopy (CD) experiments were employed to investigate the relative importance of membrane interactions of peptide-loaded microgel particles and of released peptide. For the free peptide, NR results showed membrane binding occurring preferentially in the tail region in a concentration-dependent manner. At low peptide concentration (0.3 mu M) only peptide insertion in the outer leaflet was seen, however, pronounced membrane defects and peptide present in both leaflets was observed at higher peptide concentration (5.0 LL-37 loaded into MAA microgels qualitatively mirrored these effects regarding both peptide localization within the membrane and concentration dependent defect formation. In addition, very limited membrane binding of microgel particles was observed, in agreement with FTIR-ATR and liposome leakage results. FTIR-ATR showed LL-37 to undergo alpha-helix formation on membrane insertion, also supported by CD results, the kinetics of which was substantially reduced for microgel-loaded LL-37 due to sustained peptide release. Together, these findings demonstrate that membrane interactions for microgel-loaded LL-37 are dominated by released peptide, but also that slow release of microgel-loaded LL-37 translates into kinetic effects on peptide-membrane interactions, relating to both peptide localization within the bilayer, and to bilayer structure.
Ämnesord
- MEDICIN OCH HÄLSOVETENSKAP -- Medicinska och farmaceutiska grundvetenskaper -- Farmaceutiska vetenskaper (hsv//swe)
- MEDICAL AND HEALTH SCIENCES -- Basic Medicine -- Pharmaceutical Sciences (hsv//eng)
Nyckelord
- antimicrobial peptide
- bilayer
- membrane
- microgel
- neutron reflectometry
- Pharmaceutical Physical Chemistry
- Farmaceutisk fysikalisk kemi
- Antimicrobial peptide
- Bilayer
- Membrane
- Microgel
- Neutron reflectometry
Publikations- och innehållstyp
- ref (ämneskategori)
- art (ämneskategori)
Hitta via bibliotek
Till lärosätets databas