SwePub
Sök i LIBRIS databas

  Utökad sökning

id:"swepub:oai:DiVA.org:su-36658"
 

Sökning: id:"swepub:oai:DiVA.org:su-36658" > Incorporation of an...

  • Izquierdo-Barba, IsabelStockholms universitet,Avdelningen för oorganisk kemi och strukturkemi (författare)

Incorporation of antimicrobial compounds in mesoporous silica film monolith

  • Artikel/kapitelEngelska2009

Förlag, utgivningsår, omfång ...

  • Elsevier BV,2009
  • printrdacarrier

Nummerbeteckningar

  • LIBRIS-ID:oai:DiVA.org:su-36658
  • https://urn.kb.se/resolve?urn=urn:nbn:se:su:diva-36658URI
  • https://doi.org/10.1016/j.biomaterials.2009.07.003DOI
  • https://lup.lub.lu.se/record/1490142URI
  • https://urn.kb.se/resolve?urn=urn:nbn:se:uu:diva-109440URI

Kompletterande språkuppgifter

  • Språk:engelska
  • Sammanfattning på:engelska

Ingår i deldatabas

Klassifikation

  • Ämneskategori:ref swepub-contenttype
  • Ämneskategori:art swepub-publicationtype

Anmärkningar

  • : Incorporation of the antimicrobial peptide LL-37 ([LL-37, 37 aa]), as well as low molecular weight antimicrobial chlorhexidine, into mesoporous silica was obtained using an EISA one-pot synthesis method. FTIR confirmed efficient encapsulation of both LL-37 and chlorhexidine into mesoporous silica, while XRD and TEM showed that antimicrobial agent incorporation can be achieved without greatly affecting the structure of the mesoporous silica. The modified mesoporous silica released LL-37 and chlorhexidine slowly, reaching maximum release after about 200 h. The release rate could also be controlled through incorporation of SH groups in the pore walls, adding to pore hydrophobicity and reducing the release rate by about 50% compared to the unmodified mesoporous silica. Mesoporous silica containing either LL-37 or chlorhexidine displayed potent bactericidal properties against both Gram-positive Staphylococcus aureus and Gram-negative Escherichia coli. While chlorhexidine-loaded mesoporous silica displayed an accompanying high toxicity, as judged from hemolysis, LDH release, and MTT assay, the corresponding material containing LL-37 showed very low toxicity by all these assays, comparable to that observed for mesoporous silica in the absence of antibacterial drug, as well as to the negative controls in the respective assays. Mesoporous silica containing LL-37 therefore holds potential as an implantable material or a surface coating for such materials, as it combines potent bactericidal action with low toxicity, important features for controlling implant-related infections, e.g., for multi-resistant pathogens or for cases where access to the infection site of systemically administered antibiotics is limited due to collagen capsule formation or other factors.  

Ämnesord och genrebeteckningar

Biuppslag (personer, institutioner, konferenser, titlar ...)

  • Kupferschmidt, NataliaUppsala universitet,Stockholms universitet,Avdelningen för oorganisk kemi och strukturkemi,Nanoteknologi och funktionella material(Swepub:uu)natku639 (författare)
  • Terasaki, OsamuStockholms universitet,Institutionen för fysikalisk kemi, oorganisk kemi och strukturkemi(Swepub:su)osate (författare)
  • Schmidtchen, ArturLund University,Lunds universitet,Dermatologi och venereologi, Lund,Sektion III,Institutionen för kliniska vetenskaper, Lund,Medicinska fakulteten,Dermatology and Venereology (Lund),Section III,Department of Clinical Sciences, Lund,Faculty of Medicine(Swepub:lu)derm-asc (författare)
  • Malmsten, MartinUppsala universitet,Uppsala University,Institutionen för farmaci(Swepub:uu)mamal991 (författare)
  • Vallet-Regí, Maria (författare)
  • Stockholms universitetAvdelningen för oorganisk kemi och strukturkemi (creator_code:org_t)

Sammanhörande titlar

  • Ingår i:Biomaterials: Elsevier BV30:29, s. 5729-57360142-96121878-5905

Internetlänk

Hitta via bibliotek

Till lärosätets databas

Sök utanför SwePub

Kungliga biblioteket hanterar dina personuppgifter i enlighet med EU:s dataskyddsförordning (2018), GDPR. Läs mer om hur det funkar här.
Så här hanterar KB dina uppgifter vid användning av denna tjänst.

 
pil uppåt Stäng

Kopiera och spara länken för att återkomma till aktuell vy