Sökning: WFRF:(Andrén Oliver) >
Degradable dendriti...
Degradable dendritic nanogels as carriers for antimicrobial peptides
-
- Nordström, Randi, 1986- (författare)
- Uppsala University,Uppsala universitet,Institutionen för farmaci,Farmaceutisk fysikalisk kemi,Uppsala Univ, Dept Pharm, SE-75123 Uppsala, Sweden.
-
- Andrén, Oliver C. J. (författare)
- KTH Royal Institute of Technology,KTH,Ytbehandlingsteknik,Kungliga Tekniska Högskolan
-
- Singh, Shalini, 1982- (författare)
- Uppsala University,Uppsala universitet,Institutionen för farmaci,Farmaceutisk fysikalisk kemi,Uppsala Univ, Dept Pharm, SE-75123 Uppsala, Sweden.
-
visa fler...
-
- Malkoch, Michael, 1974- (författare)
- KTH Royal Institute of Technology,KTH,Ytbehandlingsteknik,Kungliga Tekniska Högskolan
-
- Davoudi, Mina (författare)
- Lund University,Lunds universitet,Dermatologi och venereologi, Lund,Sektion III,Institutionen för kliniska vetenskaper, Lund,Medicinska fakulteten,Schmidtchen lab,Forskargrupper vid Lunds universitet,Dermatology and Venereology (Lund),Section III,Department of Clinical Sciences, Lund,Faculty of Medicine,Schmidtchen Lab,Lund University Research Groups
-
- Schmidtchen, A. (författare)
- Lund University,Lunds universitet,Dermatologi och venereologi, Lund,Sektion III,Institutionen för kliniska vetenskaper, Lund,Medicinska fakulteten,Schmidtchen lab,Forskargrupper vid Lunds universitet,Dermatology and Venereology (Lund),Section III,Department of Clinical Sciences, Lund,Faculty of Medicine,Schmidtchen Lab,Lund University Research Groups,University of Copenhagen,Bispebjerg Hospital
-
- Malmsten, Martin (författare)
- Uppsala University,Uppsala universitet,Institutionen för farmaci,Department of Pharmacy, University of Copenhagen,Farmaceutisk fysikalisk kemi,Uppsala Univ, Dept Pharm, SE-75123 Uppsala, Sweden.;Univ Copenhagen, Dept Pharm, DK-2100 Copenhagen, Denmark.
-
visa färre...
-
(creator_code:org_t)
- Elsevier BV, 2019
- 2019
- Engelska.
-
Ingår i: Journal of Colloid and Interface Science. - : Elsevier BV. - 0021-9797 .- 1095-7103. ; 554, s. 592-602
- Relaterad länk:
-
http://dx.doi.org/10...
-
visa fler...
-
https://urn.kb.se/re...
-
https://doi.org/10.1...
-
https://urn.kb.se/re...
-
https://lup.lub.lu.s...
-
visa färre...
Abstract
Ämnesord
Stäng
- In the present study, we investigate degradable anionic dendritic nanogels (DNG) as carriers for antimicrobial peptides (AMPs). In such systems, the dendritic part contains carboxylic acid-based anionic binding sites for cationic AMPs, whereas linear poly(ethylene glycol) (PEG) chains form a shell for promotion of biological stealth. In order to clarify factors influencing membrane interactions of such systems, we here address effects of nanogel charge, cross-linking, and degradation on peptide loading/release, as well as consequences of these factors for lipid membrane interactions and antimicrobial effects. The DNGs were found to bind the AMPs LL-37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES) and DPK-060 (GKHKNKGKKNGKHNGWKWWW). For the smaller DPK-060 peptide, loading was found to increase with increasing nanogel charge density. For the larger LL-37, on the other hand, peptide loading was largely insensitive to nanogel charge density. In line with this, results on the secondary structure, as well as on the absence of stabilization from proteolytic degradation by the nanogels, show that the larger LL-37 is unable to enter into the interior of the nanogels. While 40–60% nanogel degradation occurred over 10 days, promoted at high ionic strength and lower cross-linking density/higher anionic charge content, peptide release at physiological ionic strength was substantially faster, and membrane destabilization not relying on nanogel degradation. Ellipsometry and liposome leakage experiments showed both free peptide and peptide/DNG complexes to cause membrane destabilization, indicated also by antimicrobial activities being comparable for nanogel-bound and free peptide. Finally, the DNGs were demonstrated to display low toxicity towards erythrocytes even at peptide concentrations of 100 µM.
Ämnesord
- MEDICIN OCH HÄLSOVETENSKAP -- Medicinska och farmaceutiska grundvetenskaper -- Farmaceutiska vetenskaper (hsv//swe)
- MEDICAL AND HEALTH SCIENCES -- Basic Medicine -- Pharmaceutical Sciences (hsv//eng)
- NATURVETENSKAP -- Kemi -- Fysikalisk kemi (hsv//swe)
- NATURAL SCIENCES -- Chemical Sciences -- Physical Chemistry (hsv//eng)
- NATURVETENSKAP -- Biologi -- Biokemi och molekylärbiologi (hsv//swe)
- NATURAL SCIENCES -- Biological Sciences -- Biochemistry and Molecular Biology (hsv//eng)
Nyckelord
- Antimicrobial peptide
- Degradable
- Dendritic
- Hyperbranched
- drug delivery
- Membrane
- Nanogel
- Pharmaceutical Physical Chemistry
- Farmaceutisk fysikalisk kemi
- Bioteknologi
- Antimicrobial peptide
- Degradable
- Dendritic
- Hyperbranched drug delivery
- Membrane
- Nanogel
Publikations- och innehållstyp
- ref (ämneskategori)
- art (ämneskategori)
Hitta via bibliotek
Till lärosätets databas