SwePub
Sök i LIBRIS databas

  Utökad sökning

WFRF:(Andrén Oliver)
 

Sökning: WFRF:(Andrén Oliver) > Degradable dendriti...

LIBRIS Formathandbok  (Information om MARC21)
FältnamnIndikatorerMetadata
00006364naa a2200685 4500
001oai:DiVA.org:uu-389746
003SwePub
008190723s2019 | |||||||||||000 ||eng|
009oai:DiVA.org:kth-261938
009oai:lup.lub.lu.se:1cb2be29-4518-4c93-938b-5a1afabfb206
0247 a https://urn.kb.se/resolve?urn=urn:nbn:se:uu:diva-3897462 URI
0247 a https://doi.org/10.1016/j.jcis.2019.07.0282 DOI
0247 a https://urn.kb.se/resolve?urn=urn:nbn:se:kth:diva-2619382 URI
0247 a https://lup.lub.lu.se/record/1cb2be29-4518-4c93-938b-5a1afabfb2062 URI
040 a (SwePub)uud (SwePub)kthd (SwePub)lu
041 a engb eng
042 9 SwePub
072 7a ref2 swepub-contenttype
072 7a art2 swepub-publicationtype
1001 a Nordström, Randi,d 1986-u Uppsala University,Uppsala universitet,Institutionen för farmaci,Farmaceutisk fysikalisk kemi,Uppsala Univ, Dept Pharm, SE-75123 Uppsala, Sweden.4 aut0 (Swepub:uu)ranra372
2451 0a Degradable dendritic nanogels as carriers for antimicrobial peptides
264 1b Elsevier BV,c 2019
338 a print2 rdacarrier
500 a QC 20191015
520 a In the present study, we investigate degradable anionic dendritic nanogels (DNG) as carriers for antimicrobial peptides (AMPs). In such systems, the dendritic part contains carboxylic acid-based anionic binding sites for cationic AMPs, whereas linear poly(ethylene glycol) (PEG) chains form a shell for promotion of biological stealth. In order to clarify factors influencing membrane interactions of such systems, we here address effects of nanogel charge, cross-linking, and degradation on peptide loading/release, as well as consequences of these factors for lipid membrane interactions and antimicrobial effects. The DNGs were found to bind the AMPs LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW). For the smaller DPK-060 peptide, loading was found to increase with increasing nanogel charge density. For the larger LL-37, on the other hand, peptide loading was largely insensitive to nanogel charge density. In line with this, results on the secondary structure, as well as on the absence of stabilization from proteolytic degradation by the nanogels, show that the larger LL-37 is unable to enter into the interior of the nanogels. While 40–60% nanogel degradation occurred over 10 days, promoted at high ionic strength and lower cross-linking density/higher anionic charge content, peptide release at physiological ionic strength was substantially faster, and membrane destabilization not relying on nanogel degradation. Ellipsometry and liposome leakage experiments showed both free peptide and peptide/DNG complexes to cause membrane destabilization, indicated also by antimicrobial activities being comparable for nanogel-bound and free peptide. Finally, the DNGs were demonstrated to display low toxicity towards erythrocytes even at peptide concentrations of 100 µM.
650 7a MEDICIN OCH HÄLSOVETENSKAPx Medicinska och farmaceutiska grundvetenskaperx Farmaceutiska vetenskaper0 (SwePub)301012 hsv//swe
650 7a MEDICAL AND HEALTH SCIENCESx Basic Medicinex Pharmaceutical Sciences0 (SwePub)301012 hsv//eng
650 7a NATURVETENSKAPx Kemix Fysikalisk kemi0 (SwePub)104022 hsv//swe
650 7a NATURAL SCIENCESx Chemical Sciencesx Physical Chemistry0 (SwePub)104022 hsv//eng
650 7a NATURVETENSKAPx Biologix Biokemi och molekylärbiologi0 (SwePub)106022 hsv//swe
650 7a NATURAL SCIENCESx Biological Sciencesx Biochemistry and Molecular Biology0 (SwePub)106022 hsv//eng
653 a Antimicrobial peptide
653 a Degradable
653 a Dendritic
653 a Hyperbranched
653 a drug delivery
653 a Membrane
653 a Nanogel
653 a Pharmaceutical Physical Chemistry
653 a Farmaceutisk fysikalisk kemi
653 a Bioteknologi
653 a Antimicrobial peptide
653 a Degradable
653 a Dendritic
653 a Hyperbranched drug delivery
653 a Membrane
653 a Nanogel
7001 a Andrén, Oliver C. J.u KTH Royal Institute of Technology,KTH,Ytbehandlingsteknik,Kungliga Tekniska Högskolan4 aut0 (Swepub:kth)u1fshusr
7001 a Singh, Shalini,d 1982-u Uppsala University,Uppsala universitet,Institutionen för farmaci,Farmaceutisk fysikalisk kemi,Uppsala Univ, Dept Pharm, SE-75123 Uppsala, Sweden.4 aut0 (Swepub:uu)shasi194
7001 a Malkoch, Michael,d 1974-u KTH Royal Institute of Technology,KTH,Ytbehandlingsteknik,Kungliga Tekniska Högskolan4 aut0 (Swepub:kth)u18z6ljf
7001 a Davoudi, Minau Lund University,Lunds universitet,Dermatologi och venereologi, Lund,Sektion III,Institutionen för kliniska vetenskaper, Lund,Medicinska fakulteten,Schmidtchen lab,Forskargrupper vid Lunds universitet,Dermatology and Venereology (Lund),Section III,Department of Clinical Sciences, Lund,Faculty of Medicine,Schmidtchen Lab,Lund University Research Groups4 aut0 (Swepub:lu)derm-mda
7001 a Schmidtchen, A.u Lund University,Lunds universitet,Dermatologi och venereologi, Lund,Sektion III,Institutionen för kliniska vetenskaper, Lund,Medicinska fakulteten,Schmidtchen lab,Forskargrupper vid Lunds universitet,Dermatology and Venereology (Lund),Section III,Department of Clinical Sciences, Lund,Faculty of Medicine,Schmidtchen Lab,Lund University Research Groups,University of Copenhagen,Bispebjerg Hospital4 aut0 (Swepub:lu)derm-asc
7001 a Malmsten, Martinu Uppsala University,Uppsala universitet,Institutionen för farmaci,Department of Pharmacy, University of Copenhagen,Farmaceutisk fysikalisk kemi,Uppsala Univ, Dept Pharm, SE-75123 Uppsala, Sweden.;Univ Copenhagen, Dept Pharm, DK-2100 Copenhagen, Denmark.4 aut0 (Swepub:lu)ma1014ma
7102 a Uppsala universitetb Institutionen för farmaci4 org
7730 t Journal of Colloid and Interface Scienced : Elsevier BVg 554, s. 592-602q 554<592-602x 0021-9797x 1095-7103
8564 u http://dx.doi.org/10.1016/j.jcis.2019.07.028y FULLTEXT
8564 8u https://urn.kb.se/resolve?urn=urn:nbn:se:uu:diva-389746
8564 8u https://doi.org/10.1016/j.jcis.2019.07.028
8564 8u https://urn.kb.se/resolve?urn=urn:nbn:se:kth:diva-261938
8564 8u https://lup.lub.lu.se/record/1cb2be29-4518-4c93-938b-5a1afabfb206

Hitta via bibliotek

Till lärosätets databas

Kungliga biblioteket hanterar dina personuppgifter i enlighet med EU:s dataskyddsförordning (2018), GDPR. Läs mer om hur det funkar här.
Så här hanterar KB dina uppgifter vid användning av denna tjänst.

 
pil uppåt Stäng

Kopiera och spara länken för att återkomma till aktuell vy